PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G054111_P01
Common NameLOC103631701, Zm.158625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MYB
Protein Properties Length: 249aa    MW: 28669.2 Da    PI: 6.3551
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G054111_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.28.2e-181562148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT+ Ed ll ++v+q+G g+W+++a+  g++R++k+c++rw +yl
  GRMZM2G054111_P01 15 KGPWTALEDRLLTEYVQQHGEGSWNSVAKLTGLRRSGKSCRLRWVNYL 62
                       79********************************************97 PP

2Myb_DNA-binding53.17.4e-1768112147
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                        rg+ T++E+  +++++++lG++ W++Iar+++ gRt++++k++w+++
  GRMZM2G054111_P01  68 RGKITPDEETVILQLHAMLGNR-WSAIARCLP-GRTDNEIKNYWRTH 112
                        8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.8351062IPR017930Myb domain
SuperFamilySSF466891.27E-3012109IPR009057Homeodomain-like
SMARTSM007175.8E-151464IPR001005SANT/Myb domain
PfamPF002499.7E-171562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-231669IPR009057Homeodomain-like
CDDcd001675.40E-111762No hitNo description
PROSITE profilePS5129423.40363117IPR017930Myb domain
SMARTSM007179.9E-1667115IPR001005SANT/Myb domain
PfamPF002499.3E-1568112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-2470115IPR009057Homeodomain-like
CDDcd001675.23E-1172113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MDAISSLLLQ EGWRKGPWTA LEDRLLTEYV QQHGEGSWNS VAKLTGLRRS GKSCRLRWVN  60
YLRPDLKRGK ITPDEETVIL QLHAMLGNRW SAIARCLPGR TDNEIKNYWR THFKKARPSR  120
RARAQLLHQY QQQQEEERRQ YLQSLQLLQQ EQQQQQLLLQ QQSQQLVVKQ QQLEQQSPPE  180
PDHQAVMAML DSQQSTAECY CSPVPVVPEQ CCALPADDDD AMLWDSLWRL VDGDGRGCGD  240
GDDSSGVAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-271511527126MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G054111
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G054111_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9604500.0EU960450.1 Zea mays clone 224989 MYB305 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008650938.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A096QPJ70.0A0A096QPJ7_MAIZE; Uncharacterized protein
STRINGGRMZM2G054111_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132282433
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-62myb domain protein 305